Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KRT10 protein

This Human KRT10 protein spans the amino acid sequence from region 326-443aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokeratin-10 , CK-10Keratin-10 , K10

UniProt

P13645

Expression Region

326-443aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged2-530AA: 326-443AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Hedgehog Homolog, Sonic ELISA Kit
MBS045945 Inquire

Rabbit Hedgehog Homolog, Sonic ELISA Kit

Sign In for Pricing
View Details
Phospho-REC8 (Ser251) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-7726R-APC-Cy5.5 100 µL

Phospho-REC8 (Ser251) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Mir1906-1 qPCR Primer Pair
QM79422S 200 Tests

Mouse Mir1906-1 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Human Caspase-7 Antibody
orb108528 100 µg

Rabbit Human Caspase-7 Antibody

Sign In for Pricing
View Details
Cytochrome c (CYCS) Sheep ELISA Kit
C7510 96 Tests

Cytochrome c (CYCS) Sheep ELISA Kit

Sign In for Pricing
View Details
2,3,4,6-Tetrafluorobenzyl chloride
PC10545 1 Each

2,3,4,6-Tetrafluorobenzyl chloride

Sign In for Pricing
View Details