Viral UL83 protein
This Viral UL83 protein spans the amino acid sequence from region 351-480. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83
UniProt
P06725
Expression Region
351-480
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rac- (3'aR,6'aR) -1-[ (tert-Butoxy) carbonyl]-hexahydrospiro[azetidine-3,1'-furo[3,4-c]pyrrole]-3'A-carboxylic acid](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FPD79967-01 50 mg
Rac- (3'aR,6'aR) -1-[ (tert-Butoxy) carbonyl]-hexahydrospiro[azetidine-3,1'-furo[3,4-c]pyrrole]-3'A-carboxylic acid
Sign In for Pricing
View Details FPD79967-02 0.5 g
Rac- (3'aR,6'aR) -1-[ (tert-Butoxy) carbonyl]-hexahydrospiro[azetidine-3,1'-furo[3,4-c]pyrrole]-3'A-carboxylic acid
Sign In for Pricing
View Details 
MBS6466685-01 0.1 mL
Calcyclin, CT (Protein S100-A6, S100 Calcium-binding Protein A6, S100A6, Prolactin Receptor-associated Protein, PRA, Growth Factor-inducible Protein 2A9, MLN 4, CACY) (MaxLight 490)
Sign In for Pricing
View Details MBS6466685-02 5x 0.1 mL
Calcyclin, CT (Protein S100-A6, S100 Calcium-binding Protein A6, S100A6, Prolactin Receptor-associated Protein, PRA, Growth Factor-inducible Protein 2A9, MLN 4, CACY) (MaxLight 490)
Sign In for Pricing
View Details 
orb2916812-01 20 µg
Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB)
Sign In for Pricing
View Details orb2916812-02 100 µg
Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB)
Sign In for Pricing
View Details