Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB)

This Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1AVH3

Expression Region

1-258

Origin

Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVTQEELRHEILHTWEAAREAWVIHLEIAGINLSINKPVWFLWLGAAITFLFMYVGART LRDRPGAYQVLVEELFRFGRDMFGGQINEEGRKWFPYSLTLFIFLLVLNIIGLFPNSYPV TSNISFTATLALFTFVLTQYEGVRRNGLVTYLKSWAPADLPAKPLMYPIMWFLHLIQEFT KPLTLALRLYANILAGHLIIFVFLSLILYFGLPTAFVSVPFAVVFYAFEIFVAVIQAYIF AILTQVYIELAMFAEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Caspase 9 Activity Apoptosis Assay Kit *Green Fluorescence*
22799-AAT 200 Tests

Cell Meter™ Caspase 9 Activity Apoptosis Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
Anti-BiP | Lumenal-binding protein, DyLight® 488 conjugated (40 µg)
AS09 481-DL488 40 µg

Anti-BiP | Lumenal-binding protein, DyLight® 488 conjugated (40 µg)

Sign In for Pricing
View Details
WAVE 1 (WASF1) Rabbit Polyclonal Antibody
AP06594PU-N 100 µg

WAVE 1 (WASF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pivalimidamide Hydrochloride
TRC-P550695-5G 5 g

Pivalimidamide Hydrochloride

Sign In for Pricing
View Details
14,15-Epoxy-moxidectin (>85%)
TRC-E589243-250MG 250 mg

14,15-Epoxy-moxidectin (>85%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS625311 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details