Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RUNX3 protein

This Human RUNX3 protein spans the amino acid sequence from region 1-415aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acute myeloid leukemia 2 protein Core-binding factor subunit alpha-3 Short name, CBF-alpha-3

UniProt

Q13761

Expression Region

1-415aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antiangiogenic agent 7
orb2802393-01 10 mg

Antiangiogenic agent 7

Sign In for Pricing
View Details
Antiangiogenic agent 7
orb2802393-02 50 mg

Antiangiogenic agent 7

Sign In for Pricing
View Details
VGluT1 Mouse Monoclonal Antibody [A7A3]
HA601014 100 µL

VGluT1 Mouse Monoclonal Antibody [A7A3]

Sign In for Pricing
View Details
8'-Oxo-6-hydroxydihydrophaseic acid
HY-N2783 1 Each

8'-Oxo-6-hydroxydihydrophaseic acid

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Putative membrane protein insertion efficiency factor (BUsg_015)
MBS1053764-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Putative membrane protein insertion efficiency factor (BUsg_015)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Putative membrane protein insertion efficiency factor (BUsg_015)
MBS1053764-02 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Putative membrane protein insertion efficiency factor (BUsg_015)

Sign In for Pricing
View Details