Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD35 protein

This Human CD35 protein spans the amino acid sequence from region 41-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti C3 binding proteinprotein, anti C3b/C4b receptorprotein, anti C3BRprotein, anti C4BRprotein, anti CD 35protein, anti CD35protein, anti CD35 antigenprotein, anti complement component (3b/4b) receptor 1 (Knops blood group) protein, anti complement component (3b/4b) receptor 1 including Knops blood group systemprotein, anti Complement component receptor 1protein, anti Complement receptor 1protein, anti Complement receptor type 1protein, anti CR 1protein, anti CR1protein

UniProt

P17927

Expression Region

41-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal GST-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRAK1/2-IN-1
HY-152954 1 Each

DRAK1/2-IN-1

Sign In for Pricing
View Details
Angiotensin amide
TP2446-01 100 mg

Angiotensin amide

Sign In for Pricing
View Details
Angiotensin amide
TP2446-02 500 mg

Angiotensin amide

Sign In for Pricing
View Details
UBE2L3 Immunizing Peptide
orb17741 100 µg

UBE2L3 Immunizing Peptide

Sign In for Pricing
View Details
HM13 Recombinant Protein (Human)
RP014941 100 µg

HM13 Recombinant Protein (Human)

Sign In for Pricing
View Details
Polyclonal Antibody to Doublecortin (DCX)
TRV-0057403-01 20 µL

Polyclonal Antibody to Doublecortin (DCX)

Sign In for Pricing
View Details