Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Icos protein

This Rat Icos protein spans the amino acid sequence from region 21-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activation-inducible lymphocyte immunomediatory molecule CD_antigen, CD278

UniProt

Q9R1T7

Expression Region

21-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Igsf6 shRNA (UAS) - Lentiviral mouse Igsf6 shRNA (UAS, RFP) plasmid
GTR15261253 1 Vial

Lentiviral mouse Igsf6 shRNA (UAS) - Lentiviral mouse Igsf6 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Ferritin Antibody
abx022478 1 mg

Ferritin Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ANPEP mAb
MA392-01 50 μL

Rabbit Anti-Human ANPEP mAb

Sign In for Pricing
View Details
Rabbit Anti-Human ANPEP mAb
MA392-02 100 μL

Rabbit Anti-Human ANPEP mAb

Sign In for Pricing
View Details
STEAP3 Rabbit Polyclonal Antibody (HRP)
orb2120600 100 µL

STEAP3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PE/Fire™ 640 anti-human CD305 (LAIR1)
GT11734 100 Tests

PE/Fire™ 640 anti-human CD305 (LAIR1)

Sign In for Pricing
View Details