Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP3 Rabbit Polyclonal Antibody (HRP)

STEAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

STMP3, TSAP6, pHyde, AHMIO2, dudlin-2, dudulin-2

UniProt

A8K6E3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STEAP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E/E063/NT/PP-PHOLUMB-300X300-1 Fire & Disaster Signs (No Adhesive)
238662 1 Pack (1 Panel (s) x 1 Pack)

E/E063/NT/PP-PHOLUMB-300X300-1 Fire & Disaster Signs (No Adhesive)

Sign In for Pricing
View Details
ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (MaxLight 550)
MBS6216679-01 0.1 mL

ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (MaxLight 550)

Sign In for Pricing
View Details
ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (MaxLight 550)
MBS6216679-02 5x 0.1 mL

ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (MaxLight 550)

Sign In for Pricing
View Details
DDX29 CRISPR Activation Plasmid (m)
sc-432313-ACT 20 µg

DDX29 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
NEUROD6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV653728 1.0 µg DNA

NEUROD6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Na (+)/H (+) antiporter nhaB, partial
MBS1127214-01 1 mg (E-Coli)

Recombinant Citrobacter koseri Na (+)/H (+) antiporter nhaB, partial

Sign In for Pricing
View Details