What is the catalog number for Human IZUMO1R protein?

The catalog number for Human IZUMO1R protein is orb383189.

What sizes are available for Human IZUMO1R protein?

Human IZUMO1R protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human IZUMO1R protein come in?

Human IZUMO1R protein is available in 3 different pack sizes.

Is Human IZUMO1R protein in stock?

Human IZUMO1R protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human IZUMO1R protein

This Human IZUMO1R protein spans the amino acid sequence from region 20-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Folate receptor 4 Folate receptor delta Short name, FR-delta IZUMO1 receptor protein JUNO

UniProt

A6ND01

Expression Region

20-250aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS