Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lcn5 protein

This Mouse Lcn5 protein spans the amino acid sequence from region 27-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal retinoic acid-binding protein Short name, E-RABP Short name, mE-RABP Epididymal secretory protein 10 Short name, MEP 10 Cleaved into the following 2 chains, Epididymal-specific lipocalin-5, major form Epididymal-specific lipocalin-5, minor form

UniProt

A2AJB7

Expression Region

27-192aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-) -Anomalin
HY-N0947-01 5 mg

(-) -Anomalin

Sign In for Pricing
View Details
(-) -Anomalin
HY-N0947-02 10 mg

(-) -Anomalin

Sign In for Pricing
View Details
NOLC1 Antibody / Nucleolar and coiled-body phosphoprotein 1 / NOPP140
FY12841 100 µL

NOLC1 Antibody / Nucleolar and coiled-body phosphoprotein 1 / NOPP140

Sign In for Pricing
View Details
Human SIGLEC8/SAF-2 Antibody , PerCP
E55A09880 50 Tests

Human SIGLEC8/SAF-2 Antibody , PerCP

Sign In for Pricing
View Details
Ttc7b sgRNA CRISPR Lentivector set (Rat)
K6114401 3x 1.0 µg

Ttc7b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Phospho-CD3 ζ (Tyr 83) Rabbit mAb
C06430-100uL*2 2x 100μL

Phospho-CD3 ζ (Tyr 83) Rabbit mAb

Sign In for Pricing
View Details