Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MKI67 protein

This Human MKI67 protein spans the amino acid sequence from region 3120-3256aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen identified by monoclonal Ki 67 , Antigen identified by monoclonal Ki-67, Antigen KI-67, Antigen KI67 , Antigen Ki67, KI67_HUMAN, KIA, Marker of proliferation Ki-67, MIB 1, MIB, MKI67, PPP1R105, Proliferation marker protein Ki-67, Proliferation related Ki 67 antigen , Protein phosphatase 1 regulatory subunit 105, RP11-380J17.2

UniProt

P46013

Expression Region

3120-3256aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori Equine LH beta ELISA Kit
GR106531 96 Well

Nori Equine LH beta ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Cd72 shRNA (UAS) - Lentiviral mouseCd72 shRNA (UAS, GFP) (25)
GTR15165272 1 Vial

Lentiviral mouse Cd72 shRNA (UAS) - Lentiviral mouseCd72 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
UGT1A5 Peptide - N-terminal region
orb2008263 100 µg

UGT1A5 Peptide - N-terminal region

Sign In for Pricing
View Details
CLCN1 siRNA (Rat)
MBS8221360-01 15 nmol

CLCN1 siRNA (Rat)

Sign In for Pricing
View Details
CLCN1 siRNA (Rat)
MBS8221360-02 30 nmol

CLCN1 siRNA (Rat)

Sign In for Pricing
View Details
CLCN1 siRNA (Rat)
MBS8221360-03 5x 30 nmol

CLCN1 siRNA (Rat)

Sign In for Pricing
View Details