Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A5 Peptide - N-terminal region

UGT1A5, UDP glucuronosyltransferase 1 family, polypeptide A5, UDPGT; UGT1E; UDPGT 1-5; UGT1A5, UDP-glucuronosyltransferase 1-5, UDP-glucuronosyltransferase 1-5, UGT-1E, UGT1*5, OTTHUMP00000065199, UDP-glucuronosyltransferase 1-E, UDP-glucuronosyltransferase 1A5, UDP glycosyltransferase 1 family, polypeptide A5, UDP-glucuronosyltransferase 1 family polypeptide A5s

Product Specifications

Product Name Alternative

UDPGT, UGT1E, UDPGT 1-5

UniProt

P35504

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_061951

Preservative

Lyophilized powder

AA Sequence

EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB600829 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Cytochrome P450 1A1/1A2 (MC1), CF740 conjugate, 0.1mg/mL
BNC742907-500 1x 500 µL

Cytochrome P450 1A1/1A2 (MC1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL
BNC472098-500 1x 500 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-1 (CD80) (NM_005191) Human Recombinant Protein
TP306540M 100 µg

B7-1 (CD80) (NM_005191) Human Recombinant Protein

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL
BNC882885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vacuum Oven BOVA-7305
BOVA-7305 1 Unit

Vacuum Oven BOVA-7305

Sign In for Pricing
View Details