Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTC protein

This Human BTC protein spans the amino acid sequence from region 32-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTCProbetacellulin [Cleaved into, Betacellulin, BTC) ]

UniProt

P35070

Expression Region

32-178aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lubricin Double Nickase Plasmid (m2)
sc-430164-NIC-2 20 µg

Lubricin Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
OR2AT4 Antibody (C-term)
E45R30867G-1 100 µL

OR2AT4 Antibody (C-term)

Sign In for Pricing
View Details
TTLL9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
48735065 1.0 µg DNA

TTLL9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SLAMF6, Human (HEK293, His-Avi)
HY-P72415 1 Each

SLAMF6, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
PKR/EIF2AK2 Rabbit mAb (AMR12759N)
AMR12759N-01 50 µL

PKR/EIF2AK2 Rabbit mAb (AMR12759N)

Sign In for Pricing
View Details
PKR/EIF2AK2 Rabbit mAb (AMR12759N)
AMR12759N-02 100 µL

PKR/EIF2AK2 Rabbit mAb (AMR12759N)

Sign In for Pricing
View Details