Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF6, Human (HEK293, His-Avi)

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

SLAMF6 Protein, Human (HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf6-protein-human-hek-293-his-avi.html

Smiles

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK

Molecular Formula

114836 (Gene_ID) Q96DU3-1 (Q22-K225) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FA-PEG-NHS, 8K
HE057023-8K Inquire

FA-PEG-NHS, 8K

Sign In for Pricing
View Details
COL2A1 Monoclonal Antibody
MBS7135539-01 0.05 mg

COL2A1 Monoclonal Antibody

Sign In for Pricing
View Details
COL2A1 Monoclonal Antibody
MBS7135539-02 0.1 mg

COL2A1 Monoclonal Antibody

Sign In for Pricing
View Details
COL2A1 Monoclonal Antibody
MBS7135539-03 5x 0.1 mg

COL2A1 Monoclonal Antibody

Sign In for Pricing
View Details
TTLL2 Protein Vector (Human) (pPB-N-His)
PV044474 500 ng

TTLL2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SEL1L Antibody, FITC conjugated
MBS7107565-01 0.05 mg

SEL1L Antibody, FITC conjugated

Sign In for Pricing
View Details