Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF6, Human (HEK293, His-Avi)

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

SLAMF6 Protein, Human (HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf6-protein-human-hek-293-his-avi.html

Smiles

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK

Molecular Formula

114836 (Gene_ID) Q96DU3-1 (Q22-K225) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPST1 AAV siRNA Pooled Vector
47407161 1.0 µg

TPST1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Hrk, BH3 Domain (Activator of Apoptosis Harakiri, Neuronal Death Protein DP5, BH3-interacting Domain-containing Protein 3, BID3) (Biotin) discontinued
H7446-50C-Biotin 200 µL

Hrk, BH3 Domain (Activator of Apoptosis Harakiri, Neuronal Death Protein DP5, BH3-interacting Domain-containing Protein 3, BID3) (Biotin) discontinued

Sign In for Pricing
View Details
ZNF582 (HRP)
582338-01 50 µg

ZNF582 (HRP)

Sign In for Pricing
View Details
ZNF582 (HRP)
582338-02 100 µg

ZNF582 (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal mpp8 Antibody
NBP1-71808 100 µL

Rabbit Polyclonal mpp8 Antibody

Sign In for Pricing
View Details
Bovine Interleukin-12 subunit alpha,IL12A ELISA KIT
JOT-EK2334Bo 96 wells

Bovine Interleukin-12 subunit alpha,IL12A ELISA KIT

Sign In for Pricing
View Details