Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF6, Human (HEK293, His-Avi)

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

SLAMF6 Protein, Human (HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf6-protein-human-hek-293-his-avi.html

Smiles

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK

Molecular Formula

114836 (Gene_ID) Q96DU3-1 (Q22-K225) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNIP1 (NM_133372) Human Untagged Clone
SC305948 10 µg

FNIP1 (NM_133372) Human Untagged Clone

Sign In for Pricing
View Details
SLC5A8 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-6106R-PerCP-Cy5.5 100 µL

SLC5A8 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
CRKL Antibody, mAb, Rabbit
A04979-50 50 µL

CRKL Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Chicken Gallinacin-10, GAL10 ELISA KIT
ELI-27360c 96 Tests

Chicken Gallinacin-10, GAL10 ELISA KIT

Sign In for Pricing
View Details
Svs5 CRISPRa sgRNA lentivector (set of three targets)(Rat)
45934126 3x 1.0µg DNA

Svs5 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Horse AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit
MBS9938367-01 48 Well

Horse AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit

Sign In for Pricing
View Details