Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFL9 protein (Active)

This Human TNFL9 protein (Active) spans the amino acid sequence from region 71-254aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

4-1BB ligand

UniProt

P41273

Expression Region

71-254aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS­PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by stimulation of IL­8 production using human PBMC is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-ethoxybenzyl) -N-[3- (1H-imidazol-1-yl) propyl]amine
sc-354307A 1 g

N- (2-ethoxybenzyl) -N-[3- (1H-imidazol-1-yl) propyl]amine

Sign In for Pricing
View Details
PLV3-CMV-GLI1-3xHA-Fluc-Puro Plasmid
PVT84125 2 µg

PLV3-CMV-GLI1-3xHA-Fluc-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral human DHRS4 shRNA (UAS) - Lentiviral human DHRS4 shRNA (UAS) plasmid
GTR15153307 1 Vial

Lentiviral human DHRS4 shRNA (UAS) - Lentiviral human DHRS4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
α-Amylase/α-Glucosidase-IN-8
HY-162169 1 Each

α-Amylase/α-Glucosidase-IN-8

Sign In for Pricing
View Details
Recombinant IAV H5N1 Hemagglutinin / HA Protein (aa 1-531) [His] (A/Indonesia/5/2005) (HEK293 Cells)
VAng-Wyb7198-100g 100 µg

Recombinant IAV H5N1 Hemagglutinin / HA Protein (aa 1-531) [His] (A/Indonesia/5/2005) (HEK293 Cells)

Sign In for Pricing
View Details
TMSB15A Human shRNA Plasmid Kit (Locus ID 11013)
TR318769 1 Kit

TMSB15A Human shRNA Plasmid Kit (Locus ID 11013)

Sign In for Pricing
View Details