Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tspo protein

This Mouse Tspo protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial benzodiazepine receptor (PKBS) (Peripheral-type benzodiazepine receptor) (PBR) (Bzrp) (Mbr)

UniProt

P50637

Expression Region

1-169aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAF17 Protein Vector (Mouse) (pPB-C-His)
PV170666 500 ng

DCAF17 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
RO4583298
HY-129448 1 Each

RO4583298

Sign In for Pricing
View Details
Tfrc Recombinant Antibody
RAC07937-01 50 µL

Tfrc Recombinant Antibody

Sign In for Pricing
View Details
Tfrc Recombinant Antibody
RAC07937-02 100 µL

Tfrc Recombinant Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal BRDG1/STAP-1 Antibody [Allophycocyanin]
NBP3-06491APC 0.1 mL

Rabbit Polyclonal BRDG1/STAP-1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
ZNF736P10Y Protein Vector (Human) (pPM-C-HA)
51787021 500 ng

ZNF736P10Y Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details