Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hamster NEU2 protein

This Hamster NEU2 protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic sialidase (N-acetyl-alpha-neuraminidase 2)

UniProt

Q64393

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A5 CRISPR/Cas9 KO Plasmid (h)
sc-416508 20 µg

MS4A5 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
CD45R (RA3-6B2) PE
sc-19597 PE 200 µg/mL

CD45R (RA3-6B2) PE

Sign In for Pricing
View Details
ATP8B2 Protein Lysate (Mouse) with C-HA Tag
12819034 100 µg

ATP8B2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
LPPM-8
HY-158104 1 Each

LPPM-8

Sign In for Pricing
View Details
NCRNA00102 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1402606 1.0 µg DNA

NCRNA00102 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
DNA Ligase I (LIG1) Rabbit Polyclonal Antibody
TA336236 100 µL

DNA Ligase I (LIG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details