Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus VP40 protein

This Virus VP40 protein spans the amino acid sequence from region 1-326aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane-associated protein VP40

UniProt

Q77DJ6

Expression Region

1-326aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat IL-21R Protein (His Tag)
PKSR030333 100 µg

Recombinant Rat IL-21R Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Tie1 Protein (His Tag)
PKSH033171-01 10 µg

Recombinant Human Tie1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Tie1 Protein (His Tag)
PKSH033171-02 50 µg

Recombinant Human Tie1 Protein (His Tag)

Sign In for Pricing
View Details
PLGLB2 Polyclonal Antibody
E-AB-18762-01 20 µL

PLGLB2 Polyclonal Antibody

Sign In for Pricing
View Details
PLGLB2 Polyclonal Antibody
E-AB-18762-02 60 µL

PLGLB2 Polyclonal Antibody

Sign In for Pricing
View Details
PLGLB2 Polyclonal Antibody
E-AB-18762-03 120 µL

PLGLB2 Polyclonal Antibody

Sign In for Pricing
View Details