Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Haptoglobin protein

This Human Haptoglobin protein spans the amino acid sequence from region 19-406aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alternative name (s), Zonulin

UniProt

P00738

Expression Region

19-406aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNH, CT (CCNH, Cyclin-H, MO15-associated protein, p34, p37) (APC) discontinued
033413-APC 200 µL

CCNH, CT (CCNH, Cyclin-H, MO15-associated protein, p34, p37) (APC) discontinued

Sign In for Pricing
View Details
ZNF729 Protein Vector (Human) (pPM-C-His)
PV145497 500 ng

ZNF729 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SMARCA4 discontinued
394657 200 µL

SMARCA4 discontinued

Sign In for Pricing
View Details
Human azurocidin (Cationic protein 37)
HY-NP0229 1 Each

Human azurocidin (Cationic protein 37)

Sign In for Pricing
View Details
UNC5C Rabbit Polyclonal Antibody (HRP)
orb482477 100 µL

UNC5C Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FAK (phospho Tyr576) Polyclonal Antibody
RA20999-01 50 µL

FAK (phospho Tyr576) Polyclonal Antibody

Sign In for Pricing
View Details