Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PLF4 protein (Active)

This Mouse PLF4 protein (Active) spans the amino acid sequence from region 30-105aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PF-4

UniProt

Q9Z126

Expression Region

30-105aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 10-100ng/ml.

Form

Lyophilized powder

Molecular Weight

8.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 1.5 M NaCl, pH 7.4

AA Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PZM21 (Standard)
HY-101386R 1 Each

PZM21 (Standard)

Sign In for Pricing
View Details
Recombinant Thermodesulfovibrio yellowstonii Protease HtpX homolog (htpX)
MBS7017191-01 0.02 mg

Recombinant Thermodesulfovibrio yellowstonii Protease HtpX homolog (htpX)

Sign In for Pricing
View Details
Recombinant Thermodesulfovibrio yellowstonii Protease HtpX homolog (htpX)
MBS7017191-02 0.1 mg

Recombinant Thermodesulfovibrio yellowstonii Protease HtpX homolog (htpX)

Sign In for Pricing
View Details
Recombinant Thermodesulfovibrio yellowstonii Protease HtpX homolog (htpX)
MBS7017191-03 5x 0.1 mg

Recombinant Thermodesulfovibrio yellowstonii Protease HtpX homolog (htpX)

Sign In for Pricing
View Details
Recombinant Clostridium Acetobutylicum fabZ Protein (aa 1-141)
VAng-Lsx7574-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Acetobutylicum fabZ Protein (aa 1-141)

Sign In for Pricing
View Details
MA1 (h) : 293T Lysate
sc-115548 100 µg - 200 µL

MA1 (h) : 293T Lysate

Sign In for Pricing
View Details