Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL6 protein (Active)

This Human IL6 protein (Active) spans the amino acid sequence from region 30-212aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Interleukin BSF 2 protein, B cell differentiation factor protein, B cell stimulatory factor 2 protein, BSF 2 protein, BSF-2 protein, BSF2 protein, CDF protein, CTL differentiation factor protein, Cytotoxic T cell differentiation factor protein, HGF protein, HPGF protein, HSF protein, Hybridoma growth factor protein, Hybridoma growth factor Interferon beta-2 protein, Hybridoma plasmacytoma growth factor protein, IFN-beta-2 protein, IFNB2 protein, IL 6 protein, IL-6 protein, IL6 protein, IL6 protein protein, Interferon beta 2 protein, Interferon beta-2 protein, Interleukin 6 (interferon beta 2) protein, Interleukin 6 protein, Interleukin BSF 2 protein, Interleukin-6 protein, Interleukin6 protein

UniProt

P05231

Expression Region

30-212aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 7 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Caspase-2/CASP2 Antibody Picoband® (FITC Conjugate)
PB9368-FITC 100 µg/Vial

Anti-Caspase-2/CASP2 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
1,2-Dihydrotanshinone
HY-122970-01 1 mg

1,2-Dihydrotanshinone

Sign In for Pricing
View Details
1,2-Dihydrotanshinone
HY-122970-02 5 mg

1,2-Dihydrotanshinone

Sign In for Pricing
View Details
DVL1 siRNA (Rat)
orb1831415-01 15 nmol

DVL1 siRNA (Rat)

Sign In for Pricing
View Details
DVL1 siRNA (Rat)
orb1831415-02 30 nmol

DVL1 siRNA (Rat)

Sign In for Pricing
View Details
TAF II p100 rabbit pAb
ES3552-01 50 µL

TAF II p100 rabbit pAb

Sign In for Pricing
View Details