Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL17B protein (Active)

This Human IL17B protein (Active) spans the amino acid sequence from region 21-180aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-17B, Interleukin-20, IL-20, Neuronal interleukin-17-related factor

UniProt

Q9UHF5

Expression Region

21-180aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion of human HepG2 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose

AA Sequence

M+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Calpastatin Antibody (9B150)
TMAB-03580-01 25 µL

Anti-Calpastatin Antibody (9B150)

Sign In for Pricing
View Details
Anti-Calpastatin Antibody (9B150)
TMAB-03580-02 50 μL

Anti-Calpastatin Antibody (9B150)

Sign In for Pricing
View Details
Anti-Calpastatin Antibody (9B150)
TMAB-03580-03 100 µL

Anti-Calpastatin Antibody (9B150)

Sign In for Pricing
View Details
EYA4 Rabbit Polyclonal Antibody
orb588595 100 µL

EYA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Picropodophyllotoxin
2765-1 1 mg

Picropodophyllotoxin

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Nuclear Factor Kappa B2 (NFkB2)
MBS2059605-01 0.1 mL

FITC-Linked Polyclonal Antibody to Nuclear Factor Kappa B2 (NFkB2)

Sign In for Pricing
View Details