Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SRR protein

This Human SRR protein spans the amino acid sequence from region 1-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

D-serine ammonia-lyase D-serine dehydratase L-serine ammonia-lyase L-serine dehydratase

UniProt

Q9GZT4

Expression Region

1-340aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RFPL4B Knockout HEK293T cell line
GTR15417420 1 Vial

Human RFPL4B Knockout HEK293T cell line

Sign In for Pricing
View Details
Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1)
orb2902727-01 20 µg

Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1)

Sign In for Pricing
View Details
Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1)
orb2902727-02 100 µg

Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1)

Sign In for Pricing
View Details
Avenaciolide
T38054 5 mg

Avenaciolide

Sign In for Pricing
View Details
Recombinant Lemna gibba Chlorophyll a-b binding protein of LHCII type I, chloroplastic
MBS7038298-01 0.02 mg

Recombinant Lemna gibba Chlorophyll a-b binding protein of LHCII type I, chloroplastic

Sign In for Pricing
View Details
Recombinant Lemna gibba Chlorophyll a-b binding protein of LHCII type I, chloroplastic
MBS7038298-02 0.1 mg

Recombinant Lemna gibba Chlorophyll a-b binding protein of LHCII type I, chloroplastic

Sign In for Pricing
View Details