Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1)

This Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1) spans the amino acid sequence from region 22-304.

Product Specifications

Product Name Alternative

Natural cytotoxicity triggering receptor 1, Lymphocyte antigen 94 homolog, NK cell-activating receptor, Natural killer cell p46-related protein, NK-p46, NKp46, hNKp46, CD_antigen= CD335

UniProt

O76036

Expression Region

22-304

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details