Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VACWR034 protein

This Viral VACWR034 protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein K2

UniProt

P18378

Expression Region

1-88aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 Polyclonal Antibody
E-AB-70114-01 60 µL

Cyclin B1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Polyclonal Antibody
E-AB-70114-02 120 µL

Cyclin B1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Polyclonal Antibody
E-AB-70114-03 200 µL

Cyclin B1 Polyclonal Antibody

Sign In for Pricing
View Details
CABP5 Polyclonal Antibody
E-AB-18578-01 20 µL

CABP5 Polyclonal Antibody

Sign In for Pricing
View Details
CABP5 Polyclonal Antibody
E-AB-18578-02 60 µL

CABP5 Polyclonal Antibody

Sign In for Pricing
View Details
CABP5 Polyclonal Antibody
E-AB-18578-03 120 µL

CABP5 Polyclonal Antibody

Sign In for Pricing
View Details