Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial uvsY protein

This Bacterial uvsY protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UvsY, Recombination protein uvsY

UniProt

P04537

Expression Region

1-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Aurkb Pre-designed siRNA Set A
SI201218A 1 Each

Rat Aurkb Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal IL-36 beta/IL-1F8 Antibody (Jacky-1) [Alexa Fluor 532]
NBP2-80085AF532 0.1 mL

Mouse Monoclonal IL-36 beta/IL-1F8 Antibody (Jacky-1) [Alexa Fluor 532]

Sign In for Pricing
View Details
CD229 Protein, Mouse, Recombinant (His Tag)
E45M53080M2-100 100 µg

CD229 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Inward rectifier potassium channel 2 (Kcnj2)
orb2924958-01 20 µg

Recombinant Rat Inward rectifier potassium channel 2 (Kcnj2)

Sign In for Pricing
View Details
Recombinant Rat Inward rectifier potassium channel 2 (Kcnj2)
orb2924958-02 100 µg

Recombinant Rat Inward rectifier potassium channel 2 (Kcnj2)

Sign In for Pricing
View Details
HSP70-1A (HSPA1A) Mouse Monoclonal Antibody [Clone ID: SJ-70]
AM20631PU-N 100 µg

HSP70-1A (HSPA1A) Mouse Monoclonal Antibody [Clone ID: SJ-70]

Sign In for Pricing
View Details