Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Inward rectifier potassium channel 2 (Kcnj2)

This Recombinant Rat Inward rectifier potassium channel 2 (Kcnj2) spans the amino acid sequence from region 1-427.

Product Specifications

Product Name Alternative

Inward rectifier potassium channel 2, Inward rectifier K (+) channel Kir2.1, IRK-1, RBL-IRK1, Potassium channel, inwardly rectifying subfamily J member 2

UniProt

Q64273

Expression Region

1-427

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHCYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRP LRRESEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF568 conjugate, 0.1mg/mL
BNC680512-500 1x 500 µL

CD68 (KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL
BNC042818-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details