Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein Short name, Protein N

UniProt

P21700

Expression Region

1-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rift valley fever virus (strain ZH-548 M12) (RVFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(+)-[1,1'-Binaphthalene]-2,2'-diamine
TRC-B387010-2.5G 2.5 g

(R)-(+)-[1,1'-Binaphthalene]-2,2'-diamine

Sign In for Pricing
View Details
Mouse Col4a2 activation kit by CRISPRa
GA200815 1 Kit

Mouse Col4a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Transcription factor Sp4 (SP4) (NM_003112) Human Over-expression Lysate
LY418889 100 µg

Transcription factor Sp4 (SP4) (NM_003112) Human Over-expression Lysate

Sign In for Pricing
View Details
FAS/CD95 Polyclonal Antibody
D-AB-10418L-01 25 µL

FAS/CD95 Polyclonal Antibody

Sign In for Pricing
View Details
FAS/CD95 Polyclonal Antibody
D-AB-10418L-02 100 µL

FAS/CD95 Polyclonal Antibody

Sign In for Pricing
View Details
eIF4A2 Recombinant Rabbit Monoclonal Antibody [PSH01-88]
HA721746 100 µL

eIF4A2 Recombinant Rabbit Monoclonal Antibody [PSH01-88]

Sign In for Pricing
View Details