Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial MT2731 protein

This Bacterial MT2731 protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MT2731, Antitoxin MT2731

UniProt

P9WJ10

Expression Region

1-81aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF17 protein
orb594739-01 10 µg

Human FGF17 protein

Sign In for Pricing
View Details
Human FGF17 protein
orb594739-02 50 µg

Human FGF17 protein

Sign In for Pricing
View Details
Human FGF17 protein
orb594739-03 500 µg

Human FGF17 protein

Sign In for Pricing
View Details
Human FGF17 protein
orb594739-04 1 mg

Human FGF17 protein

Sign In for Pricing
View Details
Lentiviral human ATPAF2 sgRNA gene knockout kit - Lentiviral human ATPAF2 sgRNA gene knockout kit (100)
GTR15368035 1 Vial

Lentiviral human ATPAF2 sgRNA gene knockout kit - Lentiviral human ATPAF2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TICAM2, NT (TICAM2, TIRAP3, TIRP, TRAM, TIR domain-containing adapter molecule 2, Putative NF-kappa-B-activating protein 502, TRIF-related adapter molecule, Toll-like receptor adaptor protein 3, Toll/interleukin-1 receptor domain-containing protein) (MaxL
MBS6355522-01 0.1 mL

TICAM2, NT (TICAM2, TIRAP3, TIRP, TRAM, TIR domain-containing adapter molecule 2, Putative NF-kappa-B-activating protein 502, TRIF-related adapter molecule, Toll-like receptor adaptor protein 3, Toll/interleukin-1 receptor domain-containing protein) (MaxL

Sign In for Pricing
View Details