Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF17 protein

This Human FGF17 protein spans the amino acid sequence from region 23-216aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 17; FGF-17; FGF17

UniProt

O60258

Expression Region

23-216aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 2.1 ug/ml.

Form

Lyophilized powder

Molecular Weight

22.64 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Thyroid gland
CS802478 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Rab 8A (63-BJ) : m-IgG1 BP-HRP Bundle
sc-545117 1 Kit

Rab 8A (63-BJ) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
RAP55 CRISPR Activation Plasmid (m2)
sc-426359-ACT-2 20 µg

RAP55 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Complement C1q (Complement Component 1, q Subcomponent) (Biotin)
MBS6248837-01 0.1 mL

Complement C1q (Complement Component 1, q Subcomponent) (Biotin)

Sign In for Pricing
View Details
Complement C1q (Complement Component 1, q Subcomponent) (Biotin)
MBS6248837-02 5x 0.1 mL

Complement C1q (Complement Component 1, q Subcomponent) (Biotin)

Sign In for Pricing
View Details
PEG10 Protein Vector (Mouse) (pPM-C-HA)
36375025 500 ng

PEG10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details