Mouse Wisp2 protein
This Mouse Wisp2 protein spans the amino acid sequence from region 24-251aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CCN family member 5 Connective tissue growth factor-like protein Short name, CTGF-L
UniProt
Q9Z0G4
Expression Region
24-251aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HY-P990107-01 1 mg
Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8)
Sign In for Pricing
View Details HY-P990107-02 5 mg
Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8)
Sign In for Pricing
View Details HY-P990107-03 10 mg
Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8)
Sign In for Pricing
View Details 
A12581-Fluoro647 100 µg/Vial
Anti-MFAP3L Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details 
orb1587262 100 µL
Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Rabbit mAb, PE-Cy5 conjugated
Sign In for Pricing
View Details orb2919530-01 20 µg
Recombinant Vibrio cholerae serotype O1 Probable intracellular septation protein A (VC0395_A1304, VC395_1818)
Sign In for Pricing
View Details