Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat SARAF protein

This Rat SARAF protein spans the amino acid sequence from region 195-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66

UniProt

Q96BY9

Expression Region

195-339aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK6 3'UTR Luciferase Stable Cell Line
TU006249 1.0 mL

DOK6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-HMGB1 Antibody (FITC)
STJ501360 100 µg

Anti-HMGB1 Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Human CCL4
50191P-20-1 20 µg

Recombinant Human CCL4

Sign In for Pricing
View Details
ABIN3 (TNIP3) (NM_001128843) Human Tagged Lenti ORF Clone
RC225469L2 10 µg

ABIN3 (TNIP3) (NM_001128843) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
S100P Rabbit mAb
E45R13181N-100 100 µL

S100P Rabbit mAb

Sign In for Pricing
View Details
Mouse Antithrombin receptor ELISA kit
GTR10385247 96 Well

Mouse Antithrombin receptor ELISA kit

Sign In for Pricing
View Details