Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ruvB protein

This E. coli ruvB protein spans the amino acid sequence from region 1-336aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RuvB, b1860, JW1849, Holliday junction ATP-dependent DNA helicase RuvB, EC 3.6.4.12

UniProt

P0A812

Expression Region

1-336aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLZE Blocking Peptide
CBP4908-01 1 mg

MLZE Blocking Peptide

Sign In for Pricing
View Details
MLZE Blocking Peptide
CBP4908-02 5 mg

MLZE Blocking Peptide

Sign In for Pricing
View Details
GSH2 Rabbit Polyclonal Antibody (PerCP)
orb2500841 100 µL

GSH2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Losoxantrone
HY-106091 1 Each

Losoxantrone

Sign In for Pricing
View Details
Lentiviral mouse Gskip shRNA (UAS) - Lentiviral mouse Gskip shRNA (UAS, RFP) plasmid
GTR15127393 1 Vial

Lentiviral mouse Gskip shRNA (UAS) - Lentiviral mouse Gskip shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Ethyl cyclohex-2-ene-1-carboxylate
FCA51068-01 50 mg

Ethyl cyclohex-2-ene-1-carboxylate

Sign In for Pricing
View Details