Drosophila UbcD6 protein
This Drosophila UbcD6 protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ubiquitin carrier proteinUbiquitin-protein ligase
UniProt
P25153
Expression Region
1-151aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Drosophila melanogaster (Fruit fly)
Field of Research
Cancer, DNA Damage
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
33.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-SUMO-tag and expression region is 1-151aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MM 2-10 [N- (3-Triethylammoniumpropyl) -4- (4- (diethylamino) styryl) pyridinium dibromide]](https://cdn.genprice.uk/products/271/7361037/imageurl/21489-aat.webp)
21489-AAT 1 mg
MM 2-10 [N- (3-Triethylammoniumpropyl) -4- (4- (diethylamino) styryl) pyridinium dibromide]
Sign In for Pricing
View Details 
PDEO100023-01 20 µg
Recombinant Gekko japonicus PDGFC protein (His tag)
Sign In for Pricing
View Details PDEO100023-02 100 µg
Recombinant Gekko japonicus PDGFC protein (His tag)
Sign In for Pricing
View Details PDEO100023-03 500 µg
Recombinant Gekko japonicus PDGFC protein (His tag)
Sign In for Pricing
View Details