Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat alpha 1 Antitrypsin protein

This Rat alpha 1 Antitrypsin protein spans the amino acid sequence from region 25-411aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

A1A protein, A1AT protein, AAT protein, Alpha 1 antitrypsin protein, Alpha1AT protein, Dom1 protein, PI1 protein, PRO2275 protein, Serpin A1 protein, Serpin A1a protein, Serpina1 protein, Short peptide from AAT protein, SPAAT protein, Spi1-1 protein

UniProt

P17475

Expression Region

25-411aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 25-411aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A2 Peptide - middle region
orb1999497 100 µg

ALDH1A2 Peptide - middle region

Sign In for Pricing
View Details
DNASE1L1 AAV Vector (Human) (CMV)
18428101 1 µg

DNASE1L1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
COPE (A-4) : m-IgG Fc BP-HRP Bundle
sc-528766 1 Kit

COPE (A-4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
2-[ (4-methylphenyl) thio]acetonitrile
OR29815 1 Each

2-[ (4-methylphenyl) thio]acetonitrile

Sign In for Pricing
View Details
Lentiviral human LIFR shRNA (UAS) - Lentiviral human LIFR shRNA (UAS, iRFP) (25)
GTR15107510 1 Vial

Lentiviral human LIFR shRNA (UAS) - Lentiviral human LIFR shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
STX5 (STX5A, Syntaxin-5) (MaxLight 550)
MBS6214268-01 0.1 mL

STX5 (STX5A, Syntaxin-5) (MaxLight 550)

Sign In for Pricing
View Details