Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A2 Peptide - middle region

ALDH1A2 Peptide - middle region

Product Specifications

Product Name Alternative

RALDH2, RALDH2-T, RALDH (II)

UniProt

O94788

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001193826.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR79 (WRAP53) (NM_001143991) Human Tagged Lenti ORF Clone
RC227773L3 10 µg

WDR79 (WRAP53) (NM_001143991) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BTF3L4 Protein Vector (Human) (pPM-C-HA)
PV004355 500 ng

BTF3L4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) APC
MBS6380716-01 0.1 mL

HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) APC

Sign In for Pricing
View Details
HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) APC
MBS6380716-02 5x 0.1 mL

HABP4 (Intracellular Hyaluronan-binding Protein 4, IHABP-4, IHABP4, Ki-1/57 Intracellular Antigen) APC

Sign In for Pricing
View Details
PE/Cy7 Anti-human CD147 Antibody *MEM-M6/6*
114701M1-AAT 100 Tests

PE/Cy7 Anti-human CD147 Antibody *MEM-M6/6*

Sign In for Pricing
View Details
Rabbit Polyclonal ACOT2 Antibody
NBP2-92161-0.02mL 0.02 mL

Rabbit Polyclonal ACOT2 Antibody

Sign In for Pricing
View Details