Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS1 protein

This Human KIR2DS1 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIR2DS1

UniProt

Q14954

Expression Region

22-245aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csrnp2 Rat shRNA Plasmid (Locus ID 315308)
TL706657 1 Kit

Csrnp2 Rat shRNA Plasmid (Locus ID 315308)

Sign In for Pricing
View Details
CTU2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2517885 100 µL

CTU2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Virus PS/HR protein
orb604541-01 20 µg

Virus PS/HR protein

Sign In for Pricing
View Details
Virus PS/HR protein
orb604541-02 100 µg

Virus PS/HR protein

Sign In for Pricing
View Details
Virus PS/HR protein
orb604541-03 1 mg

Virus PS/HR protein

Sign In for Pricing
View Details
L- (-) -Allose
sc-295224 10 mg

L- (-) -Allose

Sign In for Pricing
View Details