Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B5

UniProt

Q01227

Expression Region

18-279aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paricalcitol 25-b-D-glucuronide
294481-01 1 mg

Paricalcitol 25-b-D-glucuronide

Sign In for Pricing
View Details
Paricalcitol 25-b-D-glucuronide
294481-02 2 mg

Paricalcitol 25-b-D-glucuronide

Sign In for Pricing
View Details
Paricalcitol 25-b-D-glucuronide
294481-03 5 mg

Paricalcitol 25-b-D-glucuronide

Sign In for Pricing
View Details
Paricalcitol 25-b-D-glucuronide
294481-04 10 mg

Paricalcitol 25-b-D-glucuronide

Sign In for Pricing
View Details
Paricalcitol 25-b-D-glucuronide
294481-05 25 mg

Paricalcitol 25-b-D-glucuronide

Sign In for Pricing
View Details
C. Elegans UNC-70/UNC Rabbit Polyclonal Antibody (APC)
orb2573495 200 µL

C. Elegans UNC-70/UNC Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details