Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast Gellan lyase protein

This Yeast Gellan lyase protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gellan lyase, EC 4.2.2.25, Fragments

UniProt

P85513

Expression Region

1-204aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Geobacillus stearothermophilus (Bacillus stearothermophilus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(4-Phenylbutoxy)benzoic Acid
TRC-P399250-50MG 50 mg

4-(4-Phenylbutoxy)benzoic Acid

Sign In for Pricing
View Details
Fibronectin (FN1) Mouse Monoclonal Antibody [Clone ID: SPM539]
AM50111PU-T 20 µg

Fibronectin (FN1) Mouse Monoclonal Antibody [Clone ID: SPM539]

Sign In for Pricing
View Details
Recombinant Human CD74 protein (His Tag)
PDEH100704-01 20 µg

Recombinant Human CD74 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD74 protein (His Tag)
PDEH100704-02 100 µg

Recombinant Human CD74 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD74 protein (His Tag)
PDEH100704-03 500 µg

Recombinant Human CD74 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD74 protein (His Tag)
PDEH100704-04 1 mg

Recombinant Human CD74 protein (His Tag)

Sign In for Pricing
View Details