Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse S100A8 protein

This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAGA protein, Calgranulin-A protein, CFAG protein, CGLA protein, Chemotactic cytokine CP-10 protein, CP-10 protein, Cystic fibrosis antigen protein, L1Ag protein, Leukocyte L1 complex light chain protein, MA387 protein, Migration inhibitory factor-related protein 8 protein, Myeloid-related protein 8 protein, Neutrophil cytosolic 7 kDa protein protein, NIF protein, Pro-inflammatory S100 cytokine protein, Protein S100-A8 protein, S100 calcium binding protein A8 (calgranulin A) protein, S100 calcium binding protein A8 protein, S100A8 protein, S100A8/S100A9 complex, included protein, Urinary stone protein band A protein, MRP8 protein, MRP-8 protein, 60B8Ag protein

UniProt

P27005

Expression Region

2-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iodoacetyl-LC-Biotin
571640 100.0mg

Iodoacetyl-LC-Biotin

Sign In for Pricing
View Details
CD300a/LMIR1, Human (HEK293, Fc-His)
HY-P70754 1 Each

CD300a/LMIR1, Human (HEK293, Fc-His)

Sign In for Pricing
View Details
Inhibin α Polyclonal Antibody
E046846 100 µg -100 µL

Inhibin α Polyclonal Antibody

Sign In for Pricing
View Details
Bovine S100-A2 ELISA Kit
OM621084 96 Strip Well

Bovine S100-A2 ELISA Kit

Sign In for Pricing
View Details
TWIST Polyclonal Antibody, Cy5.5 Conjugated
bs-2441R-Cy5.5 100 µL

TWIST Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Rat CCR9 Alexa Fluor 750 Antibody (Clone 882416)
FAB8287S-100UG 100 µg

Rat CCR9 Alexa Fluor 750 Antibody (Clone 882416)

Sign In for Pricing
View Details