Mouse S100A8 protein
This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CAGA protein, Calgranulin-A protein, CFAG protein, CGLA protein, Chemotactic cytokine CP-10 protein, CP-10 protein, Cystic fibrosis antigen protein, L1Ag protein, Leukocyte L1 complex light chain protein, MA387 protein, Migration inhibitory factor-related protein 8 protein, Myeloid-related protein 8 protein, Neutrophil cytosolic 7 kDa protein protein, NIF protein, Pro-inflammatory S100 cytokine protein, Protein S100-A8 protein, S100 calcium binding protein A8 (calgranulin A) protein, S100 calcium binding protein A8 protein, S100A8 protein, S100A8/S100A9 complex, included protein, Urinary stone protein band A protein, MRP8 protein, MRP-8 protein, 60B8Ag protein
UniProt
P27005
Expression Region
2-89aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog