Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YWHAH protein

This Human YWHAH protein spans the amino acid sequence from region 4-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YWHAH YWHA1

UniProt

Q04917

Expression Region

4-246aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NARG1/NAA15 Rabbit Polyclonal Antibody (Carrier-free)
orb3103259 100 µg

NARG1/NAA15 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Series of rocker arm microscopes+ 4K Camera
MSD205-B+4K 1 Unit

Series of rocker arm microscopes+ 4K Camera

Sign In for Pricing
View Details
Recombinant human Prohibitin 2 protein
ATGP2184-100 100 µg

Recombinant human Prohibitin 2 protein

Sign In for Pricing
View Details
KRT14-set siRNA/shRNA/RNAi Lentivector (Human)
25933091 4x 500 ng

KRT14-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
eIF3ε CRISPR Activation Plasmid (h2)
sc-405907-ACT-2 20 µg

eIF3ε CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Rara sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38514114 3x 1.0 µg

Rara sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details