Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAVER2 protein

This Human RAVER2 protein spans the amino acid sequence from region 2-691aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAVER2

UniProt

Q9HCJ3

Expression Region

2-691aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

90.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQQLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS Polyclonal Antibody
A52273-100 100 µL

KRAS Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shigella Sonnei pptA Protein (aa 2-75)
VAng-0017Lsx-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei pptA Protein (aa 2-75)

Sign In for Pricing
View Details
Human Primary Prostate Stromal Mesenchymal Stem Cells (HPS-19I)
T4199 5x105 cells / 1 mL

Human Primary Prostate Stromal Mesenchymal Stem Cells (HPS-19I)

Sign In for Pricing
View Details
Human Claudin 9,CLDN9 ELISA KIT
JOT-EK2307Hu 96 wells

Human Claudin 9,CLDN9 ELISA KIT

Sign In for Pricing
View Details
Recombinant Shigella flexneri Invasin ipaB (ipaB), partial
RPC27292-01 20 µg

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial

Sign In for Pricing
View Details
Recombinant Shigella flexneri Invasin ipaB (ipaB), partial
RPC27292-02 100 µg

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial

Sign In for Pricing
View Details