Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella flexneri. Target Name: ipaB. Target Synonyms: 62 kDa antigen (CP0128) . Accession Number: P18011. Expression Region: 1~312aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 40.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial is a purified Recombinant Protein.

Accession Number

P18011

Expression Region

1~312aa

Host

E. coli

Target

IpaB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

62 kDa antigen (CP0128)

Species

Shigella flexneri

Protein Name

Recombinant Protein

AA Sequence

MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6292608 1.0 µg DNA

Tas2r39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Goat F(ab )2 Anti-Rabbit IgG (H+L chain specific) Absorbed against human & mouse immunoglobulins
GWB-6D2633 0.5 mg

Goat F(ab )2 Anti-Rabbit IgG (H+L chain specific) Absorbed against human & mouse immunoglobulins

Sign In for Pricing
View Details
Rb (RB1) Mouse Monoclonal Antibody [Clone ID: LBI11C10]
AMM17011V 100 µL

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: LBI11C10]

Sign In for Pricing
View Details
(3-Amino-1,1,1-trifluoropropan-2-yl) dimethylamine dihydrochloride
DXC58840-01 50 mg

(3-Amino-1,1,1-trifluoropropan-2-yl) dimethylamine dihydrochloride

Sign In for Pricing
View Details
(3-Amino-1,1,1-trifluoropropan-2-yl) dimethylamine dihydrochloride
DXC58840-02 0.5 g

(3-Amino-1,1,1-trifluoropropan-2-yl) dimethylamine dihydrochloride

Sign In for Pricing
View Details
MSMP 3'UTR Luciferase Stable Cell Line
TU014773 1.0 mL

MSMP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details