Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli entG protein

This E.coli entG protein spans the amino acid sequence from region 26-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EntG

UniProt

P0A0L7

Expression Region

26-258aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Endoplasmic Reticulum Resident Protein 27 (ERP27) Protein
abx691273 100 µg

Human Endoplasmic Reticulum Resident Protein 27 (ERP27) Protein

Sign In for Pricing
View Details
Hydrochloric Acid 0.5N Solution
138200500 500 mL

Hydrochloric Acid 0.5N Solution

Sign In for Pricing
View Details
Recombinant Escherichia coli mdtJ Protein (aa 1-121) (strain HS)
VAng-Lsx02504-inquire Inquire

Recombinant Escherichia coli mdtJ Protein (aa 1-121) (strain HS)

Sign In for Pricing
View Details
FGF4 Antibody, Biotin conjugated
A21922-50UL 50 μL

FGF4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
POF1B antibody
70R-19387 50 ul

POF1B antibody

Sign In for Pricing
View Details
GYPA/CD235a, Human (P.pastoris, His)
HY-P71741 1 Each

GYPA/CD235a, Human (P.pastoris, His)

Sign In for Pricing
View Details