Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPS5P 3'UTR Luciferase Stable Cell Line
TU004831 1.0 mL

COPS5P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Clostridium Difficile pgi Protein (aa 1-449)
VAng-Lsx9257-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Difficile pgi Protein (aa 1-449)

Sign In for Pricing
View Details
Claudin 8 (CLDN8) (Biotin)
MBS6469353-01 0.1 mL

Claudin 8 (CLDN8) (Biotin)

Sign In for Pricing
View Details
Claudin 8 (CLDN8) (Biotin)
MBS6469353-02 5x 0.1 mL

Claudin 8 (CLDN8) (Biotin)

Sign In for Pricing
View Details
Wap sgRNA CRISPR Lentivector (Rat) (Target 3)
K6974304 1.0 µg DNA

Wap sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ZNF720 Recombinant Protein Antigen
NBP1-86224PEP 0.1 mL

ZNF720 Recombinant Protein Antigen

Sign In for Pricing
View Details