Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISM2 (NM_199296) Human Over-expression Lysate
LC404615 20 µg

ISM2 (NM_199296) Human Over-expression Lysate

Sign In for Pricing
View Details
Gm17660 Protein Vector (Mouse) (pPB-C-His)
PV183610 500 ng

Gm17660 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Sodium Hypophosphite (Monohydrate) 98.0-101.0%
030170-01 25 Kg

Sodium Hypophosphite (Monohydrate) 98.0-101.0%

Sign In for Pricing
View Details
Sodium Hypophosphite (Monohydrate) 98.0-101.0%
030170-02 50 Kg

Sodium Hypophosphite (Monohydrate) 98.0-101.0%

Sign In for Pricing
View Details
Sodium Hypophosphite (Monohydrate) 98.0-101.0%
030170-03 500 g

Sodium Hypophosphite (Monohydrate) 98.0-101.0%

Sign In for Pricing
View Details
Leptin Receptor Phospho-Tyr1141 (LEPR pY1141) Antibody
abx325639-01 50 µg

Leptin Receptor Phospho-Tyr1141 (LEPR pY1141) Antibody

Sign In for Pricing
View Details