Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Larp6 (NM_026235) Mouse Tagged ORF Clone
MG207894 10 µg

Larp6 (NM_026235) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Fmoc-Serinol
5-07770 25 g

Fmoc-Serinol

Sign In for Pricing
View Details
ZDHHC16 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV716977 1.0 µg DNA

ZDHHC16 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Rabbit MARCKS-related protein (MARCKSL1)
MBS965010-01 0.02 mg (E-Coli)

Recombinant Rabbit MARCKS-related protein (MARCKSL1)

Sign In for Pricing
View Details
Recombinant Rabbit MARCKS-related protein (MARCKSL1)
MBS965010-02 0.1 mg (E-Coli)

Recombinant Rabbit MARCKS-related protein (MARCKSL1)

Sign In for Pricing
View Details
Recombinant Rabbit MARCKS-related protein (MARCKSL1)
MBS965010-03 0.02 mg (Yeast)

Recombinant Rabbit MARCKS-related protein (MARCKSL1)

Sign In for Pricing
View Details