Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 20A1 (CYP20A1) Rat ELISA Kit
C7712 96 Tests

Cytochrome P450 20A1 (CYP20A1) Rat ELISA Kit

Sign In for Pricing
View Details
Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit
MBS9339735-01 48 Well

Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit

Sign In for Pricing
View Details
Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit
MBS9339735-02 96 Well

Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit

Sign In for Pricing
View Details
Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit
MBS9339735-03 5x 96 Well

Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit

Sign In for Pricing
View Details
Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit
MBS9339735-04 10x 96 Well

Bovine Retina and anterior neural fold homeobox protein 2, RAX2 ELISA Kit

Sign In for Pricing
View Details
SERPINA12 rabbit polyclonal antibody, Biotin
AP00592BT-N 50 µg

SERPINA12 rabbit polyclonal antibody, Biotin

Sign In for Pricing
View Details