Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SNRPD3 Antibody [DyLight 680]
NBP2-22306FR 0.1 mL

Rabbit Polyclonal SNRPD3 Antibody [DyLight 680]

Sign In for Pricing
View Details
Rabbit anti-human Annexin A8-like protein 2 polyclonal Antibody(ANXA8L2)
MBS1499701-01 0.05 mL

Rabbit anti-human Annexin A8-like protein 2 polyclonal Antibody(ANXA8L2)

Sign In for Pricing
View Details
Rabbit anti-human Annexin A8-like protein 2 polyclonal Antibody(ANXA8L2)
MBS1499701-02 0.1 mL

Rabbit anti-human Annexin A8-like protein 2 polyclonal Antibody(ANXA8L2)

Sign In for Pricing
View Details
Rabbit anti-human Annexin A8-like protein 2 polyclonal Antibody(ANXA8L2)
MBS1499701-03 5x 0.1 mL

Rabbit anti-human Annexin A8-like protein 2 polyclonal Antibody(ANXA8L2)

Sign In for Pricing
View Details
3'-ONH2-dGTP
HY-178533 1 Each

3'-ONH2-dGTP

Sign In for Pricing
View Details
Tert-Butyl 3-sulfanylidenepiperazine-1-carboxylate
OR1039288-01 250 mg

Tert-Butyl 3-sulfanylidenepiperazine-1-carboxylate

Sign In for Pricing
View Details