Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF11 (Center) Rabbit pAb
MBS8553325-01 0.1 mL

PRAMEF11 (Center) Rabbit pAb

Sign In for Pricing
View Details
PRAMEF11 (Center) Rabbit pAb
MBS8553325-02 0.1 mL (AF405L)

PRAMEF11 (Center) Rabbit pAb

Sign In for Pricing
View Details
PRAMEF11 (Center) Rabbit pAb
MBS8553325-03 0.1 mL (AF405S)

PRAMEF11 (Center) Rabbit pAb

Sign In for Pricing
View Details
PRAMEF11 (Center) Rabbit pAb
MBS8553325-04 0.1 mL (AF610)

PRAMEF11 (Center) Rabbit pAb

Sign In for Pricing
View Details
PRAMEF11 (Center) Rabbit pAb
MBS8553325-05 0.1 mL (AF635)

PRAMEF11 (Center) Rabbit pAb

Sign In for Pricing
View Details
PRAMEF11 (Center) Rabbit pAb
MBS8553325-06 0.1 mL (APC)

PRAMEF11 (Center) Rabbit pAb

Sign In for Pricing
View Details