Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (P.pastoris, His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 9.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal VEGF-C Antibody
APR00415G 0.1mg

Polyclonal VEGF-C Antibody

Sign In for Pricing
View Details
8-stripmagneticcomb, Ubottom
CT-8U-L 2 PCS/Bag - 144 PCS/Case

8-stripmagneticcomb, Ubottom

Sign In for Pricing
View Details
0.1M MES Buffer pH 6.0
IBS-BM020-6.0 500 mL

0.1M MES Buffer pH 6.0

Sign In for Pricing
View Details
Rabbit anti Human platelet factor 4
MBS573172-01 1 mL

Rabbit anti Human platelet factor 4

Sign In for Pricing
View Details
Rabbit anti Human platelet factor 4
MBS573172-02 5x 1 mL

Rabbit anti Human platelet factor 4

Sign In for Pricing
View Details
PSMB3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1739706 1.0 µg DNA

PSMB3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details