GYPA/CD235a, Human (P.pastoris, His)
GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html
Smiles
LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Molecular Formula
2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)
Molecular Weight
Approximately 9.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
STRADB CRISPR Knock Out 293T Cell Line (Human)
