GYPA/CD235a, Human (P.pastoris, His)
GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (P.pastoris, His) is the recombinant human-derived GYPA/CD235a protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
GYPA/CD235a Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-p-pastoris-his.html
Smiles
LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Molecular Formula
2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)
Molecular Weight
Approximately 9.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090) (AP) discontinued
Rabbit anti-Phospho KAP-1 (S824) Recombinant Monoclonal Antibody [BL-246-7B5]
![Rabbit anti-Phospho KAP-1 (S824) Recombinant Monoclonal Antibody [BL-246-7B5]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Rabbit anti-Phospho KAP-1 (S824) Recombinant Monoclonal Antibody [BL-246-7B5]