Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse AMH protein

This Mouse AMH protein spans the amino acid sequence from region 450-552aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Muellerian hormone protein, MIS protein, Muellerian inhibiting factor protein, Mullerian inhibiting substance protein, AMH protein

UniProt

P27106

Expression Region

450-552aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human PDIA4 protein
ATGP3138-100 100 µg

Recombinant human PDIA4 protein

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-01 0.02 mg (E-Coli)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-02 0.1 mg (E-Coli)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-03 0.02 mg (Yeast)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-04 0.1 mg (Yeast)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-05 0.02 mg (Baculovirus)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details