Rat TIMP1 protein
This Rat TIMP1 protein spans the amino acid sequence from region 24-217aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Clgi protein, Collagenase inhibitor protein, Collagenase inhibitor, Human protein, EPA protein, Erythroid Potentiating Activity protein, Erythroid-potentiating activity protein, Fibroblast collagenase inhibitor protein, HCI protein, Human Collagenase Inhibitor protein, Metalloproteinase inhibitor 1 protein, Metalloproteinase inhibitor 1 precursor protein, TIMP 1 protein, TIMP protein, TIMP metallopeptidase inhibitor 1 protein, TIMP-1 protein, Timp1 protein, TIMP1 protein protein, Tissue Inhibitor of Metalloproteinase 1 protein, Tissue inhibitor of metalloproteinases 1 protein, Tissue inhibitor of metalloproteinases protein
UniProt
P30120
Expression Region
24-217aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Cancer Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog