Rat eNOS protein

CNOS protein, Constitutive NOS protein, EC NOS protein, EC-NOS protein, ecNOS protein, Endothelial nitric oxidase synthase protein, Endothelial nitric oxide synthase protein, Endothelial nitric oxide synthase 3 protein, Endothelial NOS protein, eNOS protein, Nitric oxide synthase 3 (endothelial cell) protein, Nitric oxide synthase 3 protein, Nitric oxide synthase 3 endothelial cell protein, Nitric oxide synthase endothelial protein, Nitric oxide synthase, endothelial protein, NOS 3 protein, NOS III protein, NOS type III protein, NOS3 protein, NOS3_HUMAN protein, NOSIII protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ