Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast lolA protein

This Yeast lolA protein spans the amino acid sequence from region 22-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LolA

UniProt

A7ZYJ5

Expression Region

22-203aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli O9:H4 (strain HS)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr283 (m) -PR
sc-150718-PR 10 µM - 20 µL

Olfr283 (m) -PR

Sign In for Pricing
View Details
RAB8A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1770305 3x 1.0 µg

RAB8A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
AT1R antagonist 1
orb1744795-01 25 mg

AT1R antagonist 1

Sign In for Pricing
View Details
AT1R antagonist 1
orb1744795-02 50 mg

AT1R antagonist 1

Sign In for Pricing
View Details
AT1R antagonist 1
orb1744795-03 100 mg

AT1R antagonist 1

Sign In for Pricing
View Details
CDKL3 Protein (N-GST, Human)
P523250 100 µg

CDKL3 Protein (N-GST, Human)

Sign In for Pricing
View Details