Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Has2 protein

This Mouse Has2 protein spans the amino acid sequence from region 67-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Has2

UniProt

P70312

Expression Region

67-374aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS Antibody - N-terminal region : FITC (ARP55408_P050-FITC)
ARP55408_P050-FITC 100 µL

KRAS Antibody - N-terminal region : FITC (ARP55408_P050-FITC)

Sign In for Pricing
View Details
PROX1 recombinant monoclonal antibody
A5783 100ul X 3

PROX1 recombinant monoclonal antibody

Sign In for Pricing
View Details
Rabbit Anti-53BP1/TP53BP1 Polyclonal Antibody
PAV4583 100 μL

Rabbit Anti-53BP1/TP53BP1 Polyclonal Antibody

Sign In for Pricing
View Details
Human CNRIP1 knockdown cell line
ABC-KD3331 1 Vial

Human CNRIP1 knockdown cell line

Sign In for Pricing
View Details
6-Mercapto-5-octyl-1,2,3,5-tetrahydro-8-thia-5,7-diaza-cyclopenta[a]inden-4-one
sc-357921A 5 g

6-Mercapto-5-octyl-1,2,3,5-tetrahydro-8-thia-5,7-diaza-cyclopenta[a]inden-4-one

Sign In for Pricing
View Details
Lentiviral mouse Prokr2 shRNA (UAS) - Lentiviral mouse Prokr2 shRNA (UAS) (100)
GTR15233838 1 Vial

Lentiviral mouse Prokr2 shRNA (UAS) - Lentiviral mouse Prokr2 shRNA (UAS) (100)

Sign In for Pricing
View Details