Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Efna1 protein

This Rat Efna1 protein spans the amino acid sequence from region 18-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Efna1

UniProt

P97553

Expression Region

18-182aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1229 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32688154 3x 1.0 µg DNA

Olfr1229 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
KMT2B Rabbit pAb
MBS9143514-01 0.02 mL

KMT2B Rabbit pAb

Sign In for Pricing
View Details
KMT2B Rabbit pAb
MBS9143514-02 0.1 mL

KMT2B Rabbit pAb

Sign In for Pricing
View Details
KMT2B Rabbit pAb
MBS9143514-03 5x 0.1 mL

KMT2B Rabbit pAb

Sign In for Pricing
View Details
Hydroxyl-​γ-​isosanshool
orb1706173 25 mg

Hydroxyl-​γ-​isosanshool

Sign In for Pricing
View Details
Chicken anti Human IgG Fc, conjugated with Agarose
AHIgGFc-AGA-2 2 mL Bed Volume

Chicken anti Human IgG Fc, conjugated with Agarose

Sign In for Pricing
View Details